PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0325s0007.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 379aa    MW: 42692.9 Da    PI: 9.1775
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0325s0007.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33128185260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          dDgynWrKYGqK+vk+se+prsYY+Ct++gCp+kkkvers  d++++ei+Y+g+Hnh+k
  Kaladp0325s0007.2.p 128 DDGYNWRKYGQKQVKSSENPRSYYKCTFPGCPTKKKVERSL-DGEITEIVYKGSHNHPK 185
                          8****************************************.***************85 PP

2WRKY105.23.5e-33291349159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+++d ++v++tYeg+Hnh+
  Kaladp0325s0007.2.p 291 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSQGCTVRKHVERASHDLRAVITTYEGKHNHD 349
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-29114186IPR003657WRKY domain
SuperFamilySSF1182901.16E-25121186IPR003657WRKY domain
PROSITE profilePS5081123.87122186IPR003657WRKY domain
SMARTSM007746.1E-36127185IPR003657WRKY domain
PfamPF031062.3E-25128184IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-37276351IPR003657WRKY domain
SuperFamilySSF1182902.62E-29283351IPR003657WRKY domain
PROSITE profilePS5081138.871286351IPR003657WRKY domain
SMARTSM007741.4E-38291350IPR003657WRKY domain
PfamPF031062.1E-25292349IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGKIETYTLH LFFFYSVSLF TAQLLQSPTT GSFPAALSYH WGTLSTQKNA KQEDSRPQNR  60
NNLNNGYSDF TFQPESRTVS ADQQQPWNSG SRPSEQKKDD ISYEQGTGEI VNYQQAQTQS  120
MREARRSDDG YNWRKYGQKQ VKSSENPRSY YKCTFPGCPT KKKVERSLDG EITEIVYKGS  180
HNHPKPKSTR RLSSNSFLPI SAQPMHQIDG DVPERSFGSQ VAPNQSDQSA ATPENSSASV  240
DDDDRSRVGG DEPDAKRWKM ETGGEMMSAT GCRAVQEPRV VVQTTSDIDI LDDGYRWRKY  300
GQKVVKGNPN PRSYYKCTSQ GCTVRKHVER ASHDLRAVIT TYEGKHNHDV PAARGSGSHG  360
RHQQKHGCHD NFQRLIHN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-37118352878Probable WRKY transcription factor 4
2lex_A3e-37118352878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008384716.11e-126PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-101WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLC9DHZ01e-127C9DHZ0_9R
STRINGGLYMA02G39870.11e-122(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-101WRKY DNA-binding protein 33